My Account Information
Displaying 3871 to 3880 (of 7701 Products)
| Price | Product Name |
|---|---|
$383.00 ... more info |
Human APLP2 Protein (LTP10160) Product NameHuman APLP2 Protein (LTP10160) Catalog NumberLTP10160 Quantity100ug Price $ 383 In stock BackgroundAmyloid ? precursor-like protein 2 (APLP2) has been determined to serve an important role in the progression of a number of cancer... |
$406.00 ... more info |
Human APOE3/Apolipoprotein E Protein (LTP10657) Product NameHuman APOE3/Apolipoprotein E Protein (LTP10657) Catalog NumberLTP10657 Quantity100ug Price $ 406 In stock BackgroundApolipoprotein E (apoE) is a lipid carrier in both the peripheral and the central nervous systems. Lipid-loaded... |
$406.00 ... more info |
Human APOE4/Apolipoprotein E Protein (LTP10346) Product NameHuman APOE4/Apolipoprotein E Protein (LTP10346) Catalog NumberLTP10346 Quantity100ug Price $ 406 In stock BackgroundApolipoprotein E (apoE) is a lipid carrier in both the peripheral and the central nervous systems. Lipid-loaded... |
$350.00 $250.00Save: 29% off ... more info |
human Apolipoprotein E (ApoE) peptide Catalog Number: 5888, LT26009 Category: Peptide Sequence:Apolipoprotein E (apoE): CGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD Description: Apolipoprotein E (ApoE) is the most effective peptide to deliver the lysosomal enzyme arylsulfatase A (ASA)... |
$473.00 ... more info |
Human APRIL/TNFSF13 Trimer Protein (LTP10729) Product NameHuman APRIL/TNFSF13 Trimer Protein (LTP10729) Catalog NumberLTP10729 Quantity100ug Price $ 473 In stock BackgroundThe APRIL (a proliferation-inducing ligand), also known as TNFSF13, TALL2, TRDL1, and CD256, is a member of the TNF... |
$450.00 ... more info |
Product NameHuman ARTN Protein (LTP10460) Catalog NumberLTP10460 Quantity100ug Price $ 450 In stock BackgroundArtemin (ARTN) is a member of glial cell line-derived neurotrophic factor (GDNF) family of ligands, and its signaling is mediated via... |
$203.00 ... more info |
Product NameHuman AXL Protein (LTP10266) Catalog NumberLTP10266 Quantity100ug Price $ 203 In stock BackgroundAxl, a member of the TAM (Tyro3, Axl, Mer) family, and its inhibitors can specifically break the kinase signaling nodes, allowing... |
$406.00 ... more info |
Product NameHuman AXL Protein (LTP10348) Catalog NumberLTP10348 Quantity100ug Price $ 406 In stock BackgroundAxl, a member of the TAM (Tyro3, Axl, Mer) family, and its inhibitors can specifically break the kinase signaling nodes, allowing... |
$203.00 ... more info |
Product NameHuman AXL Protein (LTP11093) Catalog NumberLTP11093 Quantity100ug Price $ 203 In stock BackgroundAxl, a member of the TAM (Tyro3, Axl, Mer) family, and its inhibitors can specifically break the kinase signaling nodes, allowing... |
$293.00 ... more info |
Human B2M/beta 2-Microglobulin Protein (LTP10607) Product NameHuman B2M/beta 2-Microglobulin Protein (LTP10607) Catalog NumberLTP10607 Quantity100ug Price $ 293 In stock BackgroundThe genetic and functional analysis of ?2-microglobulin (B2M), a component of the HLA class-I complex.Acquired... |
Displaying 3871 to 3880 (of 7701 Products)
