| Apolipoprotein E (ApoE) is the most effective peptide to deliver the lysosomal enzyme arylsulfatase A (ASA) to the brain of wild type mice. The peptide delivers gold-nanoliposomes to the brain by crossing the blood-brain barrier (BBB) and reaching cancer tumors. The peptide sequence CGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD is a segment of the human Apolipoprotein E (ApoE) protein. It encompasses a unique sequence of amino acids that may have specific functional properties relevant to lipid metabolism, cellular signaling, or protein interactions. Usage and Applications: -
Drug Development Studies: This peptide sequence can serve as a valuable tool in drug development studies aimed at understanding the role of ApoE in lipid metabolism disorders, such as atherosclerosis or Alzheimer's disease. Researchers can use this peptide to investigate the binding interactions between ApoE and potential therapeutic agents targeting lipid metabolism pathways. -
Target Validation: The peptide can be utilized in validating targets related to lipid metabolism or neurodegenerative diseases. By studying the effects of this peptide on cellular processes or disease models, researchers can gain insights into the molecular mechanisms underlying ApoE-related disorders. -
Biophysical Studies: Researchers can employ techniques such as nuclear magnetic resonance (NMR) spectroscopy or X-ray crystallography to elucidate the structural characteristics of this peptide. Understanding its three-dimensional structure can provide valuable information about its binding partners and functional properties. -
Therapeutic Development: Peptides derived from ApoE sequences have shown potential therapeutic benefits in preclinical studies for conditions like Alzheimer's disease. This peptide or modified versions of it could be further explored as potential therapeutic agents for the treatment of lipid metabolism disorders or neurodegenerative diseases. -
Biomarker Discovery: Investigating the expression levels or post-translational modifications of this peptide in biological samples could contribute to the identification of novel biomarkers for diseases associated with dysregulated lipid metabolism or ApoE function. Conclusion: The peptide sequence CGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD, derived from Apolipoprotein E, holds significant promise as a versatile tool in drug studies and biomedical research. Its unique properties make it valuable for elucidating the role of ApoE in health and disease, as well as for the development of novel therapeutic strategies targeting lipid metabolism disorders and neurodegenerative conditions. |