My Account Information
Displaying 1461 to 1470 (of 7696 Products)
| Price | Product Name |
|---|---|
$343.44 ... more info |
cAMP Dependent PK Inhibitor (5-22), amide Product NamecAMP Dependent PK Inhibitor (5-22), amideProduct Quantity5mgCatalog Number LT1200Molecular Weight1969.2FormulaC84H137N29O26SequenceThr-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-NH2 |
$356.40 ... more info |
cAMP Dependent PK Inhibitor (5-24) Product NamecAMP Dependent PK Inhibitor (5-24)Product Quantity5mgCatalog Number LT1201Molecular Weight2222.4FormulaC94H108N32O31SequenceThr-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-His-Asp |
$205.20 ... more info |
cAMP Dependent Protein Kinase Substrate Product NamecAMP Dependent Protein Kinase SubstrateProduct Quantity10mgCatalog Number LT1202Molecular Weight770.9FormulaC31H58N14O9SequenceArg-Arg-Lys-Ala-Ser-Gly-Pro |
$1,200.00 ... more info |
cAMP-dependent protein kinase type II-alpha regulatory subunit Product Name Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens]: HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA Product Quantity 4mg Catalog Number LT8215 Sequence Chain A, cAMP-dependent protein kinase... |
$389.00 ... more info |
Product NameCAND1 Rabbit pAb Catalog NumberLTA24499 Quantity100ul Price $ 389 In stock DescriptionCAND1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 750-980... |
$450.00 ... more info |
Canine CD28 Protein (LTP10424) Product NameCanine CD28 Protein (LTP10424) Catalog NumberLTP10424 Quantity100ug Price $ 450 In stock BackgroundCD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is... |
$450.00 ... more info |
Canine CD28 Protein (LTP10710) Product NameCanine CD28 Protein (LTP10710) Catalog NumberLTP10710 Quantity100ug Price $ 450 In stock BackgroundCD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is... |
$473.00 ... more info |
Canine PDGF R beta/CD140b Protein (LTP10002) Product NameCanine PDGF R beta/CD140b Protein (LTP10002) Catalog NumberLTP10002 Quantity100ug Price $ 473 In stock BackgroundPDGF is a major serum mitogen that can exist as a homo or hetero-dimeric protein consisting of disulfide-linked PDGF-A... |
$406.00 ... more info |
Canine S100A9/MRP14 Protein (LTP10178) Product NameCanine S100A9/MRP14 Protein (LTP10178) Catalog NumberLTP10178 Quantity100ug Price $ 406 In stock BackgroundS100A8 and S100A9 (also known as MRP8 and MRP14, respectively) are Ca2 binding proteins belonging to the S100 family. They... |
$876.96 ... more info |
Product NameCAP - 18, rabbitProduct Quantity5mgCatalog Number LT1203Molecular... |
Displaying 1461 to 1470 (of 7696 Products)
