Amylin, rat

Product Name
Amylin, rat
Product Quantity
1mg

Product Description

Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP). Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach. amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments. amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion. Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers. CAS registry number: 124447-81-0

Catalog Number
LT0944
Molecular Weight
3920.6
Formula
C167H272N52O53S2
Sequence
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: 2-7); KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
  • 4 Units in Stock
Ask a Question

$350.00

Add to Cart: