Product Name | Amylin, rat |
Product Quantity | 1mg |
Catalog Number | LT0944 |
Molecular Weight | 3920.6 |
Formula | C167H272N52O53S2 |
Sequence | H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: 2-7); KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7) |
Product Description | Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP). Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach. amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments. amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion. Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers. CAS registry number: 124447-81-0 |
Scientific Background | Amylin, rat is a synthetic research peptide in the amylin peptide family. Amylin is a 37-residue pancreatic peptide. Human and rodent amylin differ in sequence and aggregation propensity, so species identity and modifications are important experimental variables in receptor, aggregation, and analytical studies. |
Research Applications | - amylin aggregation studies
- amylin receptor research
- species-dependent structure-function comparisons
- analytical peptide studies
|
Experimental Notes | The exact sequence, residue range, species, terminal state, and chemical modifications should be matched to the intended assay. Fragmentation or processing can materially alter receptor selectivity, potency, aggregation, or enzymatic behavior. |
Selected References | - Amylin peptide literature search
|