[Pyr3]-Amyloid β-Protein (3-42)

Product Name
[Pyr3]-Amyloid β-Protein (3-42), [Pyr3] - beta - Amyloid (3 - 42), Human
Product Description
It is one of the predominant Amyloid peptide structures deposited in human brain of Alzheimer's disease and Down's syndrome patients. It accumulates in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.
Product Quantity
1.0 mg
Purity
97.16%
Catalog Number
LT12021
Molecular Weight
4309.97
Formula
C196H299N53O55S, CAS #[183449-57-2]
Sequence
Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala, Pyr - FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
  • 4 Units in Stock

Ask a Question

$228.00

Add to Cart:
LifeTein LifeTein provides custom peptide synthesis service, recombinant proteins, peptides, cytokines, custom antibody service and custom protein service. LifeTein is the world leader in fast peptide synthesis service with lab facility located in New Jersey USA. LifeTein Logo 100 Randolph Road, Suite 2D, Somerset USA New Jersey 08873
Copyright © 2025 LifeTein.com. Powered by LifeTein