My Account Information
Displaying 5181 to 5190 (of 7696 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5604 Category: Peptide Sequence: YPRGKRGFS Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5603 Category: Peptide Sequence: LPSDSSATL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$550.00 $320.00Save: 42% off ... more info |
Catalog Number: 5602 Category: Peptide Sequence:BIRD-2 peptide: RKKRRQRRRGGNVYTEIKCNSLLPLAAIVRV Description: BIRD-2, a peptide that specifically disrupts the Bcl2/IP3R complex, was utilized to further verify the mitochondrial Ca2+... |
$1,450.00 ... more info |
Ac-KIDVPWAGQYITSNPAIRFVSIDNKKRNIESSEIGP-NH2 Catalog Number: 5601 Category: Peptide Sequence: Ac-KIDVPWAGQYITSNPAIRFVSIDNKKRNIESSEIGP-NH2 Modifications: Quantity: 200mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5600 Category: Peptide Sequence: ARESTSDPKNEQ-Lys(biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5599 Category: Peptide Sequence: SSFSTPSANYGY-Lys(biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5598 Category: Peptide Sequence: ASSFSTPSANYGYT-Lys(biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5597 Category: Peptide Sequence: AATLQSPLRKSHGGSS-Lys(Biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5596 Category: Peptide Sequence: SARESTSDPKNEQF-Lys(Biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$450.00 ... more info |
Apamin, Bee Venom - CAS 24345-16-2 Catalog Number: 5595 Name: Apamin CNCKAPETALCARRCQQH - NH2 (Disulfide bridge: 1 - 11, 3 - 15) Sequence: CNCKAPETALCARRCQQH, H-Cys¹-Asn-Cys³-Lys-Ala-Pro-Glu-Thr-Ala-Leu-Cys¹¹-Ala-Arg-Arg-Cys15-Gln-Gln-His-NH (disulfide bonds: 1 - 11; 3 -... |
Displaying 5181 to 5190 (of 7696 Products)
