My Account Information
Displaying 4451 to 4460 (of 7696 Products)
| Price | Product Name |
|---|---|
$380.00 ... more info |
Catalog Number: 6347 Category: Peptide Sequence: cyclo{RGDfK} Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6346 Category: Peptide Sequence: cyclo(RGDfV) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Myelin Oligodendrocyte Glycoprotein (35-55) rat MOG (35-55) Catalog Number: 6345 Category: Myelin Oligodendrocyte Glycoprotein (35-55) rat MOG (35-55) Sequence: Met-Glu-Val-Gly-Trp-Tyr-Arg-Ser-Pro-Phe-Ser-Arg-Val-Val-His-Leu-Tyr-Arg-Asn-Gly-Lys Description: Myelin Oligodendrocyte Glycoprotein (35-55),... |
$380.00 ... more info |
Catalog Number: 6344 Category: Peptide Sequence: cyclo(RGDfC) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6343 Category: Peptide Sequence: cyclo(RGDyC) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 6342 Category: Peptide Sequence: cyclo(RGDyK) Modifications: Quantity: 4mg Purity: >95% Notes: |
$340.00 ... more info |
Catalog Number: 6341 Category: Peptide Sequence: cyclo(RGDfK) Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
[LL-37, 37 aa] Catalog Number: 6340 Category: Peptide Sequence: [LL-37, 37 aa] Modifications: Quantity: 1mg Purity: >95% Notes: |
$576.00 $320.00Save: 44% off ... more info |
Amine-activated Peptide Conjugation Magnetic Beads Catalog Number: LT13512 Packing Details: 30mg, Lyophilized Powder The magnetic separator is not provided. Binding Capacity: 1-10 mg protein or 0.1-1mg peptide/30mg magnetic beads. Particle size: 1μm with 20 carbon linker Magnetic Beads,... |
$576.00 $320.00Save: 44% off ... more info |
Thiol-Activated Peptide Conjugation Magnetic Beads Catalog Number: LT16323 Packing Details: 30mg, Lyophilized Powder The magnetic separator is not provided. Binding Capacity: 1-10 mg protein or 0.1-1mg peptide/30mg magnetic beads. Particle size: 1μm with 20 carbon linker Magnetic Beads,... |
Displaying 4451 to 4460 (of 7696 Products)
