My Account Information
Displaying 4931 to 4940 (of 7697 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5889 Category: Peptide Sequence: MGVADLIKKFESISKEE Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 $250.00Save: 29% off ... more info |
human Apolipoprotein E (ApoE) peptide Catalog Number: 5888, LT26009 Category: Peptide Sequence:Apolipoprotein E (apoE): CGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRD Description: Apolipoprotein E (ApoE) is the most effective peptide to deliver the lysosomal enzyme arylsulfatase A (ASA)... |
$450.00 $350.00Save: 22% off ... more info |
Product Name Ovalbumin(257-264) antigen peptide SIINFEKL Product Quantity10mg Purity >95% Catalog Number LT1959 Molecular Weight963.2FormulaC45H74N10O13SequenceSer-Ile-Ile-Asn-Phe-Glu-Lys-Leu, SIINFEKL, CAS No.: 138831-86-4 Product Description OVA... |
$340.00 ... more info |
Catalog Number: 5886 Category: Peptide Sequence: EDNRRPLWEPEETVVI-{betaAla}-C Modifications: Quantity: 4mg Purity: >95% Notes: |
$340.00 ... more info |
Catalog Number: 5885 Category: Peptide Sequence: DFIEEAEVMMKLSHPK-{betaAla}-C Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5884 Category: Peptide Sequence: KKDLVFNEYRMHKARMYSQ Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5883 Category: Peptide Sequence: VAIRLPATSGAEGVPF Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Catalog Number: 5882 Category: Peptide Sequence: DRV{pSer}IHPF Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Catalog Number: 5881 Category: Peptide Sequence: DRV{pTyr}IHPF Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Catalog Number: 5880 Category: Peptide Sequence: DRVSIHPF Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4931 to 4940 (of 7697 Products)