My Account Information
Displaying 4931 to 4940 (of 7703 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5898 Category: Peptide Sequence: LSEGLGELMQRCPSRLPG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: LT5897 Category:Peptide Sequence: NKGLRNK Formula: C34H65N15O9 Quantity: 4mg Purity: >95% MW: 827.99 Description: Key Features : Targeted Action : NKGLRNK, a placental-homing peptide, is engineered to... |
$280.00 ... more info |
Catalog Number: 5896 Category: Peptide Sequence: CDEAGGATDPSCAYSSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5895 Category: Peptide Sequence: CDEAGGATDPSCAYSSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5894 Category: Peptide Sequence: TWQRRQRKDRRT Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5893 Category: Peptide Sequence: TWQRRQRKARRT Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5892 Category: Peptide Sequence: SGTGGPGGGCGTGTGSGPGGTG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 $149.00Save: 47% off ... more info |
Catalog Number: 5891 Category: Peptide Sequence:GspA: MAADIISTIGDLVKWIIDTVNKFKK Description: GLP-1 stimulating peptide (GspA) presents in GLP-1 positive but absents in GLP-1 neutral S. epidermidis. This novel S. epidermidis peptide modulates... |
$580.00 ... more info |
{For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF Catalog Number: 5890 Category: Peptide Sequence: {For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5889 Category: Peptide Sequence: MGVADLIKKFESISKEE Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4931 to 4940 (of 7703 Products)