My Account Information
| Price | Product Name |
|---|---|
| ... more info | SARS-CoV-2 Spike S1 (Q14-A684) Protein Description : SARS-CoV-2 Spike S1 (Q14-A684) Protein Product : Recombinant protein of severe acute respiratory syndrome coronavirus 2 Spike S1 (Q14-A684), with a rabbit IgG Fc tag. ... |
| ... more info | SARS-CoV-2 Variant E484K Spike RBD Protein Description :SARS-CoV-2 Variant E484K Spike RBD Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute respiratory syndrome coronavirus 2... |
| ... more info | SARS-CoV-2 Variant K417N Spike RBD Protein Description :SARS-CoV-2 Variant K417N Spike RBD Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute respiratory syndrome coronavirus 2... |
| ... more info | SARS-CoV-2 B.1.1.7 Variant (UK) Spike RBD (N501Y) Mutant Protein Description :SARS-CoV-2 B.1.1.7 Variant (UK) Spike RBD (N501Y) Mutant Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute respiratory... |
| ... more info | SARS-CoV-2 P.1 Variant (Brazil & Japan) Spike RBD (K417T/E484K/N Description :SARS-CoV-2 P.1 Variant (Brazil & Japan) Spike RBD (K417T/E484K/N501Y) Mutant Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe... |
| ... more info | SARS-CoV-2 B.1.351 Variant (South Africa) Spike RBD (K417N/E484K Description :SARS-CoV-2 B.1.351 Variant (South Africa) Spike RBD (K417N/E484K/N501Y) Mutant Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe... |
$1,140.00 ... more info |
Peptide Vaccine Testing Samples The SARS-CoV-2 virus (a.k.a. 2019-nCoV; disease: COVID-19) is responsible for the plague year of 2020. The Pfizer-BioNTech and Moderna mRNA vaccines have now been approved for emergency use and more are coming down the pipeline. The best vaccine... |
$860.40 ... more info |
Catalog Number: 66967-1 Category: Peptide Sequence: MeV NP P04851 Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$860.40 ... more info |
MeV NP P04851.1 411-453 (43aa) Catalog Number: 66967-2 Category: Peptide Sequence: MeV NP P04851.1 411-453 Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$960.00 ... more info |
S961-GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY United States Patent Application 20210018520: COMPOSITIONS FOR AND METHODS OF DIAGNOSING, PROGNOSING, AND TREATING DIABETES LifeTein synthesized the S961 peptides. S961 is a biosynthetic insulin receptor antagonist that inhibits cell proliferation... |
