My Account Information

Displaying 491 to 500 (of 7704 Products)
Price Product Name
$390.00
... more info

{Mal}-GTLTFQFRNPNFGGNPSNGAFLLDSAQAQ

Catalog Number: 6277 Category: Peptide Sequence: {Mal}-GTLTFQFRNPNFGGNPSNGAFLLDSAQAQ Modifications: Quantity: 4mg Purity: >95% Notes:
$280.00
... more info

{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH

Catalog Number: 5797 Category: Peptide Sequence: {Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH Modifications: Quantity: 1mg Purity: >95% Notes:
$450.00
... more info

{Myr}-GWKKQSLPATGQEHHHHHH

Catalog Number: 5717 Category: Peptide Sequence: {Myr}-GWKKQSLPATGQEHHHHHH Modifications: Quantity: 50mg Purity: >95% Notes:
$380.00
... more info

{Myr}-RQIKIWFQNR RMKWKKGGEI KDDVIEECNK HGGVIHIYVD KNSAQGNVYV HHHHHH

Catalog Number: 6023 Category: Peptide Sequence: {Myr}-RQIKIWFQNR RMKWKKGGEI KDDVIEECNK HGGVIHIYVD KNSAQGNVYV HHHHHH Modifications: Quantity: 4mg Purity: >90% Notes:
$380.00
... more info

{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRRPVGSENLYFQSYVGG-Lys(Biotin)

Catalog Number: 6214 Category: Peptide Sequence: {Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRRPVGSENLYFQSYVGG-Lys(Biotin) Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus...
$350.00
... more info

{Pra}-CDEFQRSTTY

Catalog Number: 6024 Category: Peptide Sequence: {Pra}-CDEFQRSTTY Modifications: Quantity: 4mg Purity: >95% Notes:
$450.00
... more info

{Pra}-CDEFQRSTTY

Catalog Number: 5752 Category: Peptide Sequence: {Pra}-CDEFQRSTTY Modifications: Quantity: 100mg Purity: >95% Notes:
$450.00
... more info

{Pra}-CQDSETRTFY

Catalog Number: 5753 Category: Peptide Sequence: {Pra}-CQDSETRTFY Modifications: Quantity: 100mg Purity: >95% Notes:
$450.00
... more info

{Pra}-CQDSETRTFY

Catalog Number: 6025 Category: Peptide Sequence: {Pra}-CQDSETRTFY Modifications: Quantity: 100mg Purity: >95% Notes:
$450.00
... more info

{Rhodamine B}-{Ahx}-LPETGS

Catalog Number: 6272 Category: Peptide Sequence: {Rhodamine B}-{Ahx}-LPETGS Formula: C59H82O14N9 Quantity: 4mg Purity: >95% Molecular Weight: 1141.14 Notes: Other related LPETG products: Cat. No Product Name Applications ...
Displaying 491 to 500 (of 7704 Products)