{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH

Product Name
{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH
Product Quantity
1mg
Catalog Number
5797
Category
Peptide
Sequence
{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH
Purity
>95%
Scientific Background

{Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-HHHHHH is a synthetic hexahistidine (His6) tag-containing peptide. This product contains a hexahistidine sequence (HHHHHH). Polyhistidine tags coordinate immobilized transition-metal ions and are widely used in immobilized metal affinity chromatography, especially Ni-NTA and cobalt-based capture.

Research Applications
  • Ni-NTA or cobalt affinity-capture studies
  • IMAC method development
  • metal-binding comparisons
  • His-tag accessibility controls
Experimental Notes

The behavior of a motif embedded in a longer peptide can differ from the isolated tag or parent sequence. Flanking residues, linkers, phosphorylation, fluorophores, affinity handles, cyclization, and terminal modifications may alter accessibility, binding, uptake, or assay performance.

Selected References
  1. One-step purification of recombinant proteins with the 6xHis/Ni-NTA system
  2. Rapid evaluation of nickel binding properties of polyhistidine tags
  • 1 Units in Stock
Ask a Question

$280.00

Add to Cart: