My Account Information

Displaying 3571 to 3580 (of 7701 Products)
Price Product Name
$1,075.68
... more info

Growth Hormone Releasing Factor, GRF (1 - 44), amide,bovine

Product NameGrowth Hormone Releasing Factor, GRF (1 - 44), amide,bovineProduct Quantity5mgCatalog Number LT1546Molecular...
$959.04
... more info

Growth Hormone Releasing Factor, GRF, (1 - 40), human

Product NameGrowth Hormone Releasing Factor, GRF, (1 - 40), humanProduct Quantity5mgCatalog Number LT1547Molecular...
$324.48
... more info

Growth Hormone Releasing Hormone Human

Product Name :Growth Hormone Releasing Hormone Human, Sermorelin, GHRH(1-29)NH2, GRF(1-29)NH2, Growth Hormone-Releasing Factor(1-29)Amide, hGHRH(1-29)NH2, or Sermorelin Acetate, Somatotropin-Releasing-Hormone(1-29)Amide Catalog Number : LTP4491...
$285.12
... more info

GRP (1-16) (porcine)

Product NameGRP (1-16) (porcine)Product Quantity5mgCatalog Number LT1548Molecular Weight1546.9FormulaC70H115N17O20S1SequenceAla-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro
$252.72
... more info

GRP (14-27) (human, porcine,canine)

Product NameGRP (14-27) (human, porcine,canine)Product Quantity5mgCatalog Number LT1549Molecular Weight1668FormulaC75H110N24O16S2SequenceMet-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
$501.00
... more info

Grp75/MOT/HSPA9 Rabbit mAb

Product NameGrp75/MOT/HSPA9 Rabbit mAb Catalog NumberLTA21970 Quantity100ul Price $ 501 In stock DescriptionGrp75/MOT/HSPA9 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids...
$389.00
... more info

Grp75/MOT/HSPA9 Rabbit pAb

Product NameGrp75/MOT/HSPA9 Rabbit pAb Catalog NumberLTA20649 Quantity100ul Price $ 389 In stock DescriptionGrp75/MOT/HSPA9 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to...
$389.00
... more info

Grp94 Rabbit pAb

Product NameGrp94 Rabbit pAb Catalog NumberLTA20962 Quantity100ul Price $ 389 In stock DescriptionGrp94 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 550-650 of human...
$719.28
... more info

GRPP (human)

Product NameGRPP (human)Product Quantity5mgCatalog Number LT1550Molecular Weight3384.53FormulaC136H215N41O58SSequenceArg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp
$1,440.00
... more info

GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG

Product Name NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration Size 12 mg Catalog # LT441773 US$ $1,200 Purity >95% Description NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer...
Displaying 3571 to 3580 (of 7701 Products)