My Account Information
Displaying 281 to 290 (of 7696 Products)
| Price | Product Name |
|---|---|
$389.00 ... more info |
Product NameAIF Rabbit pAb Catalog NumberLTA20833 Quantity100ul Price $ 389 In stock DescriptionAIF Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 334-613 of... |
$389.00 ... more info |
Product NameAIF1/IBA1 Rabbit pAb Catalog NumberLTA22883 Quantity100ul Price $ 389 In stock DescriptionAIF1/IBA1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$389.00 ... more info |
Product NameAIFM2/AMID Rabbit pAb Catalog NumberLTA22656 Quantity100ul Price $ 389 In stock DescriptionAIFM2/AMID Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$250.00 ... more info |
Catalog Number: 5150 Category: Peptide Sequence: AIGLGAMFLGC Modifications: Quantity: 2 mg Purity: >95% Formula: C47H77N11O12S2 Molecular Weight: 1052.32 For research purposes only! Not for human or animal therapeutic or diagnostic... |
$280.00 ... more info |
Catalog Number: 5913 Category: Peptide Sequence: AIHIEGHFHVHQLKL Modifications: Quantity: 2mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameAIP Rabbit pAb Catalog NumberLTA23028 Quantity100ul Price $ 389 In stock DescriptionAIP Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of... |
$389.00 ... more info |
Product NameAIPL1 Rabbit pAb Catalog NumberLTA24361 Quantity100ul Price $ 389 In stock DescriptionAIPL1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-384 of... |
$389.00 ... more info |
Product NameAIRE Rabbit pAb Catalog NumberLTA24409 Quantity100ul Price $ 389 In stock DescriptionAIRE Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of... |
$280.00 ... more info |
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Catalog Number: 6335 Category: Peptide Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameAK1 Rabbit pAb Catalog NumberLTA22705 Quantity100ul Price $ 389 In stock DescriptionAK1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of... |
Displaying 281 to 290 (of 7696 Products)