My Account Information
Displaying 2341 to 2350 (of 7701 Products)
| Price | Product Name |
|---|---|
$226.80 ... more info |
Corazonin, American Cockroach, Periplaneta americana Product NameCorazonin, American Cockroach, Periplaneta americanaProduct Quantity5mg Product Description Corazonin is a highly conserved and cardioaccelerating peptide, which has been isolated from the corpus cardiacum of the American cockroach,... |
$389.00 ... more info |
Product NameCoREST/RCOR1 Rabbit pAb Catalog NumberLTA23307 Quantity100ul Price $ 389 In stock DescriptionCoREST/RCOR1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino... |
$389.00 ... more info |
Product NameCORIN Rabbit pAb Catalog NumberLTA21391 Quantity100ul Price $ 389 In stock DescriptionCORIN Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of... |
$960.00 ... more info |
Coronavirus SARS-CoV-2 Spike S1 RBD Protein, polyhistidine tag Featured Product New! : Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Description :2019 Coronavirus SARS-CoV-2 Spike S1 RBD Protein, polyhistidine tag. Reference: A highly conserved cryptic epitope in the receptor-binding domains of... |
$2,880.00 ... more info |
Coronavirus SARS-CoV-2 Spike S1 RBD Protein, polyhistidine tag Featured Product New! : Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Description :2019 Coronavirus SARS-CoV-2 Spike S1 RBD Protein, polyhistidine tag. Reference: A highly conserved cryptic epitope in the receptor-binding domains of... |
$389.00 ... more info |
Product NameCortactin Rabbit pAb Catalog NumberLTA20012 Quantity100ul Price $ 389 In stock DescriptionCortactin Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$790.56 ... more info |
Product NameCorticostatin, humanProduct Quantity5mgCatalog Number LT1274Molecular... |
$810.00 ... more info |
Product NameCorticostatin, rabbitProduct Quantity5mgCatalog Number LT1275Molecular... |
$1,004.40 ... more info |
Corticotropin Releasing Factor, human, rat Product NameCorticotropin Releasing Factor,human, ratProduct Quantity5mg Product Description Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and... |
$350.00 $99.00Save: 72% off ... more info |
Corticotropin Releasing Factor, human, rat [86784-80-7] Catalog Number: LT8173 Category: Peptide Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, amidation Chemistry : Sequence:... |
Displaying 2341 to 2350 (of 7701 Products)
