My Account Information
Displaying 1971 to 1980 (of 7701 Products)
| Price | Product Name |
|---|---|
$501.00 ... more info |
Product NameCaMKII Rabbit mAb Catalog NumberLTA20373 Quantity100ul Price $ 501 In stock DescriptionCaMKII Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human... |
$501.00 ... more info |
Product NameCaMKII Rabbit mAb Catalog NumberLTA20381 Quantity100ul Price $ 501 In stock DescriptionCaMKII Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human... |
$389.00 ... more info |
Product NameCAMLG Rabbit pAb Catalog NumberLTA24063 Quantity100ul Price $ 389 In stock DescriptionCAMLG Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of... |
$343.44 ... more info |
cAMP Dependent PK Inhibitor (5-22), amide Product NamecAMP Dependent PK Inhibitor (5-22), amideProduct Quantity5mgCatalog Number LT1200Molecular Weight1969.2FormulaC84H137N29O26SequenceThr-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-NH2 |
$356.40 ... more info |
cAMP Dependent PK Inhibitor (5-24) Product NamecAMP Dependent PK Inhibitor (5-24)Product Quantity5mgCatalog Number LT1201Molecular Weight2222.4FormulaC94H108N32O31SequenceThr-Thr-Tyr-Ala-Asp-Phe-Ile-Ala-Ser-Gly-Arg-Thr-Gly-Arg-Arg-Asn-Ala-Ile-His-Asp |
$205.20 ... more info |
cAMP Dependent Protein Kinase Substrate Product NamecAMP Dependent Protein Kinase SubstrateProduct Quantity10mgCatalog Number LT1202Molecular Weight770.9FormulaC31H58N14O9SequenceArg-Arg-Lys-Ala-Ser-Gly-Pro |
$1,200.00 ... more info |
cAMP-dependent protein kinase type II-alpha regulatory subunit Product Name Chain A, cAMP-dependent protein kinase type II-alpha regulatory subunit [Homo sapiens]: HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA Product Quantity 4mg Catalog Number LT8215 Sequence Chain A, cAMP-dependent protein kinase... |
$389.00 ... more info |
Product NameCAND1 Rabbit pAb Catalog NumberLTA24499 Quantity100ul Price $ 389 In stock DescriptionCAND1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 750-980... |
$450.00 ... more info |
Canine CD28 Protein (LTP10424) Product NameCanine CD28 Protein (LTP10424) Catalog NumberLTP10424 Quantity100ug Price $ 450 In stock BackgroundCD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is... |
$450.00 ... more info |
Canine CD28 Protein (LTP10710) Product NameCanine CD28 Protein (LTP10710) Catalog NumberLTP10710 Quantity100ug Price $ 450 In stock BackgroundCD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is... |
Displaying 1971 to 1980 (of 7701 Products)
