My Account Information
Displaying 1931 to 1940 (of 7696 Products)
| Price | Product Name |
|---|---|
$800.00 ... more info |
Curli production assembly transport protein CsgF Product Name Curli production assembly/transport protein CsgF [Escherichia coli] TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) Product Quantity 4mg Catalog Number LT8216 Sequence Curli production assembly/transport protein CsgF... |
$389.00 ... more info |
Product NameCWC22 Rabbit pAb Catalog NumberLTA23545 Quantity100ul Price $ 389 In stock DescriptionCWC22 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 639-908... |
$389.00 ... more info |
Product NameCX3CL1 Rabbit pAb Catalog NumberLTA24422 Quantity100ul Price $ 389 In stock DescriptionCX3CL1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence within amino acids 318-397 of human... |
$389.00 ... more info |
Product NameCXCL12 Rabbit pAb Catalog NumberLTA23669 Quantity100ul Price $ 389 In stock DescriptionCXCL12 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 40 to the... |
$389.00 ... more info |
Product NameCXCL2 Rabbit pAb Catalog NumberLTA23115 Quantity100ul Price $ 389 In stock DescriptionCXCL2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of... |
$501.00 ... more info |
Product NameCXCR3 Rabbit mAb Catalog NumberLTA21995 Quantity100ul Price $ 501 In stock DescriptionCXCR3 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human... |
$389.00 ... more info |
Product NameCXCR3 Rabbit pAb Catalog NumberLTA22189 Quantity100ul Price $ 389 In stock DescriptionCXCR3 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of... |
$389.00 ... more info |
Product NameCXCR4 Rabbit pAb Catalog NumberLTA23464 Quantity100ul Price $ 389 In stock DescriptionCXCR4 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CXCR4... |
$389.00 ... more info |
Product NameCXXC1 Rabbit pAb Catalog NumberLTA23810 Quantity100ul Price $ 389 In stock DescriptionCXXC1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of... |
$234.00 ... more info |
Specifications Description Structure Abs/Em Spectra Abs/Em Maxima 553/569 nm Extinction Coefficient 150,000 Flow Cytometry Laser Line 532, 555 or 568 nm Microscopy Laser Line 532 or 555 nm ... |
Displaying 1931 to 1940 (of 7696 Products)