My Account Information
Displaying 1401 to 1410 (of 7701 Products)
| Price | Product Name |
|---|---|
| ... more info | Catalog Number: 5467 Category: Peptide Sequence: Biotin-Ahx-LPETGS-NH2, Biotin–aminohexanoic acid–LPETGS (C-terminal amide) How to dissolve Biotin-LPETGS? More information about Biotin-Ahx-LPETGS-NH2 Quantity: 5 mg, 100 mg, 1 gram ... |
$280.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEKYLKEIQNSL Catalog Number: 6240 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHIEKYLKEIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$420.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLKTIKNSL Catalog Number: 6238 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLKTIKNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$420.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLNKIKNSI Catalog Number: 6239 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHIEQYLNKIKNSI Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDKHITEYLKKIKNSI Catalog Number: 6243 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDKHITEYLKKIKNSI Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYIKKIQNSL Catalog Number: 6241 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYIKKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKIIKNSL Catalog Number: 6242 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKIIKNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$420.00 ... more info |
Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKTIQNSL Catalog Number: 6237 Category: Peptide Sequence: Biotin-Ahx-NANNAVKNNNNEEPSDQHIEKYLKTIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6178 Category: Peptide Sequence: Biotin-Ahx-NANP Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Catalog Number: 6179 Category: Peptide Sequence: Biotin-Ahx-NANPNANPNANP Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 1401 to 1410 (of 7701 Products)