My Account Information
Displaying 1391 to 1400 (of 7701 Products)
| Price | Product Name |
|---|---|
$390.00 ... more info |
Biotin-Ahx-DANANANNAVKNNNNEEPS Catalog Number: 6257 Category: Peptide Sequence: Biotin-Ahx-DANANANNAVKNNNNEEPS Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-DEDANANNAVKNNNNEEPS Catalog Number: 6258 Category: Peptide Sequence: Biotin-Ahx-DEDANANNAVKNNNNEEPS Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-DENAKANNAVKNNNNEEPS Catalog Number: 6254 Category: Peptide Sequence: Biotin-Ahx-DENAKANNAVKNNNNEEPS Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-DENANANNAVKNNNNEEPS Catalog Number: 6255 Category: Peptide Sequence: Biotin-Ahx-DENANANNAVKNNNNEEPS Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Biotin-Ahx-GGSENLYFQSYVGG-{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRR Catalog Number: 6213 Category: Peptide Sequence: Biotin-Ahx-GGSENLYFQSYVGG-{Nle}-P-{D-Phe}-R-{D-Trp}-FKAVGKKRR Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus... |
$380.00 ... more info |
Biotin-Ahx-KANNAVKNNNNEEPSDKHIEQYLKTIQNSL Catalog Number: 6236 Category: Peptide Sequence: Biotin-Ahx-KANNAVKNNNNEEPSDKHIEQYLKTIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
Biotin-Ahx-KANNAVKNNNNEEPSDKHIKEYLNKIQNSL Catalog Number: 6244 Category: Peptide Sequence: Biotin-Ahx-KANNAVKNNNNEEPSDKHIKEYLNKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Product Name:Biotin-Ahx-LPETG-NH2 Catalog Number: 6148 Sequence: Biotin-Ahx-LPETG-NH2 Description: Biotin, Ahx linker, amidation; The majority of Staphylococcus aureus virulence- and colonization-associated surface proteins contain a... |
$280.00 ... more info |
Catalog Number: 6142 Category: Peptide Sequence: Biotin-Ahx-LPETGS-COOH, Check the original amidated version here. Modifications: Biotin, Ahx linker, free acid; The majority of Staphylococcus aureus virulence- and colonization-associated... |
| ... more info | Catalog Number: 5467 Category: Peptide Sequence: Biotin-Ahx-LPETGS-NH2, Biotin–aminohexanoic acid–LPETGS (C-terminal amide) How to dissolve Biotin-LPETGS? More information about Biotin-Ahx-LPETGS-NH2 Quantity: 5 mg, 100 mg, 1 gram ... |
Displaying 1391 to 1400 (of 7701 Products)
