My Account Information
Displaying 5081 to 5090 (of 7696 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5704 Category: Peptide Sequence: SKITDILAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5703 Category: Peptide Sequence: IKITTMLAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$340.00 ... more info |
Catalog Number: 5702 Category: Peptide Sequence: RTLHDIGPEIRRAISGDL Modifications: Quantity: 4mg Purity: >95% Notes: |
$330.00 ... more info |
Catalog Number: 5701 Category: Peptide Sequence: RGFLRSASLGRRASFHL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5700 Category: Peptide Sequence: DLLINRSGWTCTQPGGRIKTTTVS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
QFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQ Catalog Number: 5699 Category: Peptide Sequence: QFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQ Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5698 Category: Peptide Sequence: KTLPDNSGWMCATGNKIKTTRIHPRT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5697 Category: Peptide Sequence: SLQHTFQQHHLHRPEGGTCEVIAAHR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5696 Category: Peptide Sequence: IVYRDGNPY Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5695 Category: Peptide Sequence: FAFRDLCIVY Modifications: Quantity: 1-4mg Purity: >95% Description: The peptide sequence FAFRDLCIVY has been identified as a novel T-cell epitope in immunological research. This... |
Displaying 5081 to 5090 (of 7696 Products)
