My Account Information
Displaying 4771 to 4780 (of 7696 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
KCNTATCVTQRLANFLVRSSNNLGAILSPTNVGSNTY Catalog Number: 6036 Category: Peptide Sequence: KCNTATCVTQRLANFLVRSSNNLGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLLRSSNNLGAIYSPTNVGSNTY Catalog Number: 6035 Category: Peptide Sequence: KCNTATCVTQRLANFLLRSSNNLGAIYSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLADFLLRSSNNLGAILSPTNVGSNTY Catalog Number: 6034 Category: Peptide Sequence: KCNTATCVTQRLADFLLRSSNNLGAILSPTNVGSNTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6033 Category: Peptide Sequence: KCNTATCVTQRLADFLVRSSSNIGAIYS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
KCNTATCVTQRLANFLLRSSNNLGAILSPT Catalog Number: 6032 Category: Peptide Sequence: KCNTATCVTQRLANFLLRSSNNLGAILSPT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
ASPQQAAYCYEQCNVNKVPFDQCYQMCSPLERS-acid Catalog Number: 6031 Category: Peptide Sequence: ASPQQAAYCYEQCNVNKVPFDQCYQMCSPLERS-acid, Disulfide Bridge: 9-27, 13-23 Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS-acid Catalog Number: 6030 Category: Peptide Sequence: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS-acid, Disulfide Bridge: 9-27, 13-23 Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Biotin-KKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6028 Category: Peptide Sequence: Biotin-KKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Biotin-KKGFYKKKQCRPSKGRKRGFCWAVD Catalog Number: 6027 Category: Peptide Sequence: Biotin-KKGFYKKKQCRPSKGRKRGFCWAVD Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$650.00 ... more info |
Catalog Number: 6026 Category: Peptide Sequence: KRKQEEVSAAIIQRNFRKYLLKQRLKNI Modifications: Quantity: 50mg Purity: >95% Notes: |
Displaying 4771 to 4780 (of 7696 Products)
