My Account Information
Displaying 4691 to 4700 (of 7696 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Product Name VEGF mimicking peptide: KLTWQELYQLKYKGI; Related products KQLLWIRSGDRPWYTS; Ac-LTYQDLLQLQY-{D-Arg}-NH2 Product Quantity 4mg Catalog Number LT6116 Molecular Weight 1952.3 Sequence Ac-KLTWQELYQLKYKGI-NH2 Product... |
$280.00 ... more info |
Catalog Number: 6115 Category: Peptide Sequence: VTFDLGFC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6114 Category: Peptide Sequence: FSVTFDLGFC Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6113 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Catalog Number: 6112 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAV-{D-Asp}-{D-Lys}-{D-Tyr} Catalog Number: 6111 Category: Peptide Sequence: SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAV-{D-Asp}-{D-Lys}-{D-Tyr} Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
{D-Ser}-LNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6110 Category: Peptide Sequence: {D-Ser}-LNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6109 Category: Peptide Sequence: SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6108 Category: Peptide Sequence: MTWCDYFTPSRGKVRKSGGGG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6107 Category: Peptide Sequence: LLASGAGRMPVYRSHLT Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4691 to 4700 (of 7696 Products)
