My Account Information
Displaying 4511 to 4520 (of 7696 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 6286 Category: Peptide Sequence: GPKGTGYIKTELISVS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
RQPKIWFPNRRKPWKKTKKSTKTINPSKYQTIRK Catalog Number: 6285 Category: Peptide Sequence: RQPKIWFPNRRKPWKKTKKSTKTINPSKYQTIRK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6284 Category: Peptide Sequence: RQPKIWFPNRRKPWKKRPRPDDLEI Modifications: Quantity: 4mg Purity: >95% Notes: |
$580.00 ... more info |
Catalog Number: 6283 Category: Peptide Sequence: Cys-GGPDRVRAVSHWSSGG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6282 Category: Peptide Sequence: LYQNVGTYV Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6281 Category: Peptide Sequence: PCKPHKEYKHKCSKLKVICK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6280 Category: Peptide Sequence: ECKNHKQYKHKPSKRKALCK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6279 Category: Peptide Sequence: LCKRHKNYKHKRSKCKAQCK Modifications: Quantity: 4mg Purity: >95% Notes: |
$320.00 ... more info |
Catalog Number: 6278 Category: Peptide Sequence: TCKNHKFSKHKYNKNKNNCK Modifications: Quantity: 4mg Purity: >95% Notes: |
$390.00 ... more info |
{Mal}-GTLTFQFRNPNFGGNPSNGAFLLDSAQAQ Catalog Number: 6277 Category: Peptide Sequence: {Mal}-GTLTFQFRNPNFGGNPSNGAFLLDSAQAQ Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4511 to 4520 (of 7696 Products)
