My Account Information
Displaying 7341 to 7350 (of 7709 Products)
| Price | Product Name |
|---|---|
$557.28 ... more info |
Product NamePeptide B, bovineProduct Quantity5mgCatalog Number LT2032Molecular Weight3657.08FormulaC163H239N39O53S2SequencePhe-Ala-Glu-Pro-Leu-Pro-Ser-Glu-Glu-Glu-Gly-Glu-Ser-Tyr-Ser-Lys-Glu-Val-Pro-Glu-Met-Glu-Lys-Arg-Tyr-Gly-Gly-Phe-Met-Arg-Phe |
$609.12 ... more info |
Product NamePeptide F, bovineProduct Quantity5mgCatalog Number LT2033Molecular... |
$324.00 ... more info |
Product NamePeptide Standard 1Product Quantity5mgCatalog Number LT2034Molecular Weight2152.52FormulaC98H144N25O26S2SequenceCys-Pro-Asp-Phe-Gly-His-Ile-Ala-Met-Glu-Leu-Ser-Val-Arg-Thr-Trp-Lys-Tyr |
$226.80 ... more info |
Product NamePeptide TProduct Quantity5mgCatalog Number LT2035Molecular Weight857.8FormulaC35H55N9O16SequenceAla-Ser-Thr-Thr-Thr-Asn-Tyr-Thr |
$447.12 ... more info |
Peptide YY (13-36) (canine,mouse, porcine, rat) Product NamePeptide YY (13-36) (canine,mouse, porcine, rat)Product Quantity5mgCatalog Number LT2036Molecular Weight3014.4FormulaC135H209N41O38SequenceSer-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
$280.00 ... more info |
Product Name Peptide YY (3-36) (human) Product Description PYY (3-36) (human), with the sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 and a molecular weight of 4049.52 g/mol, is a biologically active peptide derived from the human... |
$881.28 ... more info |
Peptide YY (canine, mouse,porcine, rat) Product NamePeptide YY (canine, mouse,porcine, rat)Product Quantity5mgCatalog Number LT2038Molecular... |
$881.28 ... more info |
Product NamePeptide YY, HumanProduct Quantity5mg Product Description Peptide YY (PYY) is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent. Catalog... |
$835.92 ... more info |
Product NamePeptide YY(3-36), PYY, humanProduct Quantity5mgCatalog Number LT2039Molecular... |
$205.20 ... more info |
Product NameModulating Peptide, C-Terminal FragmentProduct Quantity10mgCatalog Number LT1848Molecular Weight545.65FormulaC25H39N9O5SequencePro-Gln-Arg-Phe-NH2 |
Displaying 7341 to 7350 (of 7709 Products)
