My Account Information
Displaying 5071 to 5080 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5727 Category: Peptide Sequence: Biotin-DATADEQGEFEEEEGEDEA Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5726 Category: Peptide Sequence: Biotin-SNEGGNEEEGEEY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5725 Category: Peptide Sequence: Biotin-SGDGEGEGAEEY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Catalog Number: 5724 Category: Peptide Sequence: CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5723 Category: Peptide Sequence: GWS Modifications: Quantity: 1mg Purity: 90 % Notes: |
$280.00 ... more info |
Catalog Number: 5722 Category: Peptide Sequence: LQS Modifications: Quantity: 1mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5721 Category: Peptide Sequence: SSL Modifications: Quantity: 1mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5720 Category: Peptide Sequence: {D-Ser}LGAEQ Modifications: Quantity: 100mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 5719 Category: Peptide Sequence: EVSGLEQLESIINFEKLTEWTSSNVME Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5718 Category: Peptide Sequence: SIINFEKL-Cys， SIINFEKL is a well-known epitope derived from the ovalbumin protein (OVA), a major component of egg whites. It represents an 8-amino acid sequence... |
Displaying 5071 to 5080 (of 7707 Products)
