My Account Information
Displaying 4851 to 4860 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5980 Category: Peptide Sequence: LSPFRGRSR-{pSer}-APPNLWA Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$175.00 ... more info |
LL - 37,Cathelicidin, Antimicrobial Peptide, human Product Name LL37, Cathelicidin, Antimicrobial Peptide, human Product Quantity 1 mg, 5 mg Purity >95% Catalog Number LT12016 Molecular Weight4493.37 FormulaC205H340N60O53Sequence (One-Letter Code)[LL-37, 37 aa] Sequence... |
$280.00 ... more info |
Catalog Number: 5979 Category: Peptide Sequence: LSQRQRST-{pSer}-TPNVHM Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5978 Category: Peptide Sequence: SGTGGPGGGCGTGTGSGPGGTG Modifications: Quantity: 4mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5977 Category: Peptide Sequence: Erythropoietin Short Peptide JM-4 28-46: GCAEHCSLNENITVPDTKV, Erythropoietin (EPO) is a 165 amino acid glycoprotein hormone. JM-4 peptide contains a disulfide bond motif. The peptide... |
$280.00 ... more info |
Catalog Number: 5976 Category: Peptide Sequence: WPDSIASGVAQPSPSELTMSEGTGG Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5975 Category: Peptide Sequence: EYFDLNHFSGVIFLKRPFINLTAGQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5974 Category: Peptide Sequence: NYELQYYEKM Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5973 Category: Peptide Sequence: QPNGVILNY Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5972 Category: Peptide Sequence: DQPNGVILNY Modifications: Quantity: 1-4mg Purity: >95% Notes: |
Displaying 4851 to 4860 (of 7707 Products)
