My Account Information
Displaying 4711 to 4720 (of 7707 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6109 Category: Peptide Sequence: SLNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6108 Category: Peptide Sequence: MTWCDYFTPSRGKVRKSGGGG Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6107 Category: Peptide Sequence: LLASGAGRMPVYRSHLT Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6106 Category: Peptide Sequence: LLASGAGRMPVCCSNEN Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6105 Category: Peptide Sequence: LLASGAGRMPVCPPTEP Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6104 Category: Peptide Sequence: LLALTLAWSPRCRWRLR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6103 Category: Peptide Sequence: LLALTLAWSPRCRTTTY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6102 Category: Peptide Sequence: LLALTLAWSPRCTPRSY Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6101 Category: Peptide Sequence: MASSAELDFNLQALLEQLS Modifications: Quantity: 4mg Purity: >95% Notes: |
$98.00 ... more info |
Product Name HHHHHHC, 6His-Cysteine Product Description The HHHHHH-Cysteine peptide (6His) is used as a fusion tag for immunoaffinity chromatography, which is consisted of six amino acids (HHHHHH). It allows elution under non-denaturing conditions.... |
Displaying 4711 to 4720 (of 7707 Products)
