My Account Information
Displaying 4561 to 4570 (of 7697 Products)
| Price | Product Name |
|---|---|
$380.00 ... more info |
Biotin-Ahx-KANNAVKNNNNEEPSDKHIEQYLKTIQNSL Catalog Number: 6236 Category: Peptide Sequence: Biotin-Ahx-KANNAVKNNNNEEPSDKHIEQYLKTIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Biotin-Ahx-NANSAVKNNNNEEPSDKHIKEYLNKIQNSL Catalog Number: 6235 Category: Peptide Sequence: Biotin-Ahx-NANSAVKNNNNEEPSDKHIKEYLNKIQNSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6234 Category: Peptide Sequence: C-KQFIENGSEFAQKLLKKFSLLKPWA Modifications: Quantity: 2mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6233 Category: Peptide Sequence: C-KQFIENGSEFAQKLLKKFSLLKPWA Modifications: Quantity: 3mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6232 Category: Peptide Sequence: C-KQFIENGSEFAQKLLKKFSLLKPWA Modifications: Quantity: 2mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6231 Category: Peptide Sequence: C-KQFIENGSEFAQKLLKKFSLLKPWA Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
Catalog Number: 6230 Category: Peptide Sequence: C-KQFIENGSEFAQKLLKKFSLLKPWA Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6229 Category: Peptide Sequence: C-KQFIENGSEFAQKLLKKFSLLKPWA Modifications: Quantity: 3mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6228 Category: Peptide Sequence: LQSVVSQAVDKLCGAHCRDGRPLFP Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6227 Category: Peptide Sequence: VFSPVSAMEPLGWQLTSGPNQEQVS Modifications: Quantity: 1-4mg Purity: >95% Notes: |
Displaying 4561 to 4570 (of 7697 Products)