My Account Information
| Price | Product Name |
|---|---|
| ... more info | SARS-CoV-2 P.1 Variant (Brazil & Japan) Spike RBD (K417T/E484K/N Description :SARS-CoV-2 P.1 Variant (Brazil & Japan) Spike RBD (K417T/E484K/N501Y) Mutant Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe... |
| ... more info | SARS-CoV-2 B.1.351 Variant (South Africa) Spike RBD (K417N/E484K Description :SARS-CoV-2 B.1.351 Variant (South Africa) Spike RBD (K417N/E484K/N501Y) Mutant Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe... |
$1,140.00 ... more info |
Peptide Vaccine Testing Samples The SARS-CoV-2 virus (a.k.a. 2019-nCoV; disease: COVID-19) is responsible for the plague year of 2020. The Pfizer-BioNTech and Moderna mRNA vaccines have now been approved for emergency use and more are coming down the pipeline. The best vaccine... |
$860.40 ... more info |
Catalog Number: 66967-1 Category: Peptide Sequence: MeV NP P04851 Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$860.40 ... more info |
MeV NP P04851.1 411-453 (43aa) Catalog Number: 66967-2 Category: Peptide Sequence: MeV NP P04851.1 411-453 Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$960.00 ... more info |
S961-GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY United States Patent Application 20210018520: COMPOSITIONS FOR AND METHODS OF DIAGNOSING, PROGNOSING, AND TREATING DIABETES LifeTein synthesized the S961 peptides. S961 is a biosynthetic insulin receptor antagonist that inhibits cell proliferation... |
$650.00 $220.00Save: 66% off ... more info |
Catalog #: LT483449 Sequence: {DABCYL}-KTSAVLQSGFRKM-E(EDANS) Molecular Formula: C95H141N25O24S2 Molecular Weight: 2081.39 Quantity: 5mg Purity: >95% CAS Registry #: 730985-86-1 Dabcyl-KTSAVLQSGFRKME-Edans : Dabcyl-KTSAVLQSGFRKME-Edans, TFA,... |
$300.00 ... more info |
NLVPMVATV CMV pp65 (495 - 503) Product NameCEF20, Cytomegalovirus, CMV pp65 (495 - 503), NLVPMVATV Product Quantity 5 mg, >97% Purity by HPLC Product DescriptionAntigen Peptide CMV pp65 is HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503). Human... |
| ... more info | Monoclonal Antibodies to Coronavirus SARS-CoV-2 RBD Domain Catalog Number : LTA-V010-1MG Name : SARS-CoV-2 Spike RBD Monoclonal Antibody Immunogens : Utilizes 2019 novel Coronavirus spike protein receptor binding domain as the immunogens for monoclonal antibody production Antibody Subtype : IgG1... |
| ... more info | SARS-CoV-2 B.1.617 Variant (India) Spike RBD (L452R/E484Q) Mutan Description :SARS-CoV-2 B.1.617 Variant (India) Spike RBD (L452R/E484Q) Mutant Protein Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute... |