My Account Information

Displaying 4361 to 4370 (of 7704 Products)
Price Product Name
... more info

SARS-CoV-2 Spike S1 (Q14-A684) Protein

Description : SARS-CoV-2 Spike S1 (Q14-A684) Protein                                         Product : Recombinant protein of severe acute respiratory syndrome coronavirus 2 Spike S1 (Q14-A684), with a rabbit IgG Fc tag.      ...
... more info

SARS-CoV-2 Variant E484K Spike RBD Protein

Description :SARS-CoV-2 Variant E484K Spike RBD Protein                                         Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute respiratory syndrome coronavirus 2...
... more info

SARS-CoV-2 Variant K417N Spike RBD Protein

Description :SARS-CoV-2 Variant K417N Spike RBD Protein                                         Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute respiratory syndrome coronavirus 2...
... more info

SARS-CoV-2 B.1.1.7 Variant (UK) Spike RBD (N501Y) Mutant Protein

Description :SARS-CoV-2 B.1.1.7 Variant (UK) Spike RBD (N501Y) Mutant Protein                                         Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe acute respiratory...
... more info

SARS-CoV-2 P.1 Variant (Brazil & Japan) Spike RBD (K417T/E484K/N

Description :SARS-CoV-2 P.1 Variant (Brazil & Japan) Spike RBD (K417T/E484K/N501Y) Mutant Protein                                         Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe...
... more info

SARS-CoV-2 B.1.351 Variant (South Africa) Spike RBD (K417N/E484K

Description :SARS-CoV-2 B.1.351 Variant (South Africa) Spike RBD (K417N/E484K/N501Y) Mutant Protein                                         Product : Recombinant protein of receptor binding domain (RBD, Arg319-Phe541) of severe...
$1,140.00
... more info

Peptide Vaccine Testing Samples

The SARS-CoV-2 virus (a.k.a. 2019-nCoV; disease: COVID-19) is responsible for the plague year of 2020. The Pfizer-BioNTech and Moderna mRNA vaccines have now been approved for emergency use and more are coming down the pipeline. The best vaccine...
$860.40
... more info

MeV NP P04851.1 401-443(43aa)

Catalog Number: 66967-1 Category: Peptide Sequence: MeV NP P04851 Modifications: Quantity: 1-4mg Purity: >95% Notes:
$860.40
... more info

MeV NP P04851.1 411-453 (43aa)

Catalog Number: 66967-2 Category: Peptide Sequence: MeV NP P04851.1 411-453 Modifications: Quantity: 1-4mg Purity: >95% Notes:
$960.00
... more info

S961-GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY

United States Patent Application 20210018520: COMPOSITIONS FOR AND METHODS OF DIAGNOSING, PROGNOSING, AND TREATING DIABETES LifeTein synthesized the S961 peptides. S961 is a biosynthetic insulin receptor antagonist that inhibits cell proliferation...
Displaying 4361 to 4370 (of 7704 Products)