My Account Information

Displaying 791 to 800 (of 7701 Products)
Price Product Name
$389.00
... more info

AGTRAP Rabbit pAb

Product NameAGTRAP Rabbit pAb Catalog NumberLTA22703 Quantity100ul Price $ 389 In stock DescriptionAGTRAP Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 93-152...
$389.00
... more info

AIF Rabbit pAb

Product NameAIF Rabbit pAb Catalog NumberLTA20833 Quantity100ul Price $ 389 In stock DescriptionAIF Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 334-613 of...
$389.00
... more info

AIF1/IBA1 Rabbit pAb

Product NameAIF1/IBA1 Rabbit pAb Catalog NumberLTA22883 Quantity100ul Price $ 389 In stock DescriptionAIF1/IBA1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids...
$389.00
... more info

AIFM2/AMID Rabbit pAb

Product NameAIFM2/AMID Rabbit pAb Catalog NumberLTA22656 Quantity100ul Price $ 389 In stock DescriptionAIFM2/AMID Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids...
$250.00
... more info

AIGLGAMFLGC

Catalog Number: 5150 Category: Peptide Sequence: AIGLGAMFLGC Modifications: Quantity: 2 mg Purity: >95% Formula: C47H77N11O12S2 Molecular Weight: 1052.32 For research purposes only! Not for human or animal therapeutic or diagnostic...
$280.00
... more info

AIHIEGHFHVHQLKL

Catalog Number: 5913 Category: Peptide Sequence: AIHIEGHFHVHQLKL Modifications: Quantity: 2mg Purity: >95% Notes:
$389.00
... more info

AIP Rabbit pAb

Product NameAIP Rabbit pAb Catalog NumberLTA23028 Quantity100ul Price $ 389 In stock DescriptionAIP Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of...
$389.00
... more info

AIPL1 Rabbit pAb

Product NameAIPL1 Rabbit pAb Catalog NumberLTA24361 Quantity100ul Price $ 389 In stock DescriptionAIPL1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-384 of...
$389.00
... more info

AIRE Rabbit pAb

Product NameAIRE Rabbit pAb Catalog NumberLTA24409 Quantity100ul Price $ 389 In stock DescriptionAIRE Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of...
$280.00
... more info

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Catalog Number: 6335 Category: Peptide Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Modifications: Quantity: 4mg Purity: >95% Notes:
Displaying 791 to 800 (of 7701 Products)