My Account Information

Displaying 7071 to 7080 (of 7701 Products)
Price Product Name
$280.00
... more info

STLVEKWVFKSSTLPQFSLSSAIT

Catalog Number: 6129 Category: Peptide Sequence: STLVEKWVFKSSTLPQFSLSSAIT Modifications: Quantity: 1-4mg Purity: >95% Notes:
$389.00
... more info

STOML2 Rabbit pAb

Product NameSTOML2 Rabbit pAb Catalog NumberLTA21384 Quantity100ul Price $ 389 In stock DescriptionSTOML2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 29-356...
$350.00
... more info

STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC

Catalog Number: 5803 Category: Peptide Sequence: STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC Modifications: Quantity: 4mg Purity: >95% Notes:
$389.00
... more info

STRADA Rabbit pAb

Product NameSTRADA Rabbit pAb Catalog NumberLTA20043 Quantity100ul Price $ 389 In stock DescriptionSTRADA Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 25-210...
$389.00
... more info

STRAP Rabbit pAb

Product NameSTRAP Rabbit pAb Catalog NumberLTA20025 Quantity100ul Price $ 389 In stock DescriptionSTRAP Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of...
$576.00 $320.00Save: 44% off
... more info

Streptavidin Magnetic Beads

Faster Magnetic Response; Simpler Protocols; LifeTein provides a series of magnetic beads for any bioseparation application, from microliter scale to liter scale. Our Magnetic Beads are nano-superparamagnetic beads covalently coated with highly...
$933.12
... more info

Stresscopin-Related Peptide (6-43) (human)

Product NameStresscopin-Related Peptide (6-43) (human)Product Quantity5mgCatalog Number LT2251Molecular...
$1,030.32
... more info

Stresscopin-Related Peptide (free acid) (human)

Product NameStresscopin-Related Peptide (free acid) (human)Product Quantity5mgCatalog Number LT2252Molecular...
$1,049.76
... more info

Stresscopin-Related Peptide,human

Product NameStresscopin-Related Peptide,humanProduct Quantity5mgCatalog Number LT2253Molecular...
$978.48
... more info

Stresscopin, human

Product NameStresscopin, humanProduct Quantity5mgCatalog Number LT2250Molecular...
Displaying 7071 to 7080 (of 7701 Products)