Scientific Background | STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFGAQIMVAAKGC is a 48-residue synthetic peptide with the sequence Ser-Thr-Gln-Ser-Asn-Lys-Lys-Asp-Leu-Cys-Glu-His-Tyr-Arg-Gln-Ile-Ala-Lys-Glu-Ser-Cys-Lys-Lys-Gly-Phe-Leu-Gly-Val-Arg-Asp-Gly-Thr-Ala-Gly-Ala-Cys-Phe-Gly-Ala-Gln-Ile-Met-Val-Ala-Ala-Lys-Gly-Cys. The sequence contains 4 cysteine residues, allowing thiol/disulfide chemistry when available; contains 6 Lys and 2 Arg residues, contributing cationic character; contains 3 aromatic residues. These sequence-derived properties describe the reagent chemically; no specific biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended conditions. |
