My Account Information
Displaying 6841 to 6850 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5704 Category: Peptide Sequence: SKITDILAKLGKVLAHV Modifications: Quantity: 4mg Purity: >95% Notes: |
$250.00 ... more info |
Catalog Number: 5320 Category: Peptide Sequence: SKLNHHHHTVHRGHSPG Modifications: Quantity: 4 mg Purity: >95% Formula: C82H124N34O22 Molecular Weight: 1938.11 For research purposes only! Not for human or animal therapeutic or... |
$389.00 ... more info |
Product NameSKP2 Rabbit pAb Catalog NumberLTA20853 Quantity100ul Price $ 389 In stock DescriptionSKP2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of... |
$350.00 ... more info |
SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Catalog Number: 6154 Category: Peptide Sequence: SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Modifications: Quantity: 4mg Purity: >95% Notes: |
$270.00 ... more info |
Product NameSL9, HIV - 1 p17 (77 - 85)Product Quantity10mg Product Description HIV-1 gag p17 protein is an attractive target for molecular intervention, because it is involved in the viral replication cycle at both the pre- and postintegration... |
$389.00 ... more info |
Product NameSLA2 Rabbit pAb Catalog NumberLTA23280 Quantity100ul Price $ 389 In stock DescriptionSLA2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of... |
$389.00 ... more info |
Product NameSLAMF6 Rabbit pAb Catalog NumberLTA21324 Quantity100ul Price $ 389 In stock DescriptionSLAMF6 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 22-226... |
$389.00 ... more info |
Product NameSLAMF7 Rabbit pAb Catalog NumberLTA24385 Quantity100ul Price $ 389 In stock DescriptionSLAMF7 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 23-226... |
$389.00 ... more info |
Product NameSLC12A1 Rabbit pAb Catalog NumberLTA23434 Quantity100ul Price $ 389 In stock DescriptionSLC12A1 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 50-150 of human... |
$389.00 ... more info |
Product NameSLC12A2 Rabbit pAb Catalog NumberLTA22259 Quantity100ul Price $ 389 In stock DescriptionSLC12A2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
Displaying 6841 to 6850 (of 7701 Products)
