My Account Information
Displaying 6601 to 6610 (of 7701 Products)
| Price | Product Name |
|---|---|
$350.00 ... more info |
RQIKIWFQNR RMKWKKGLSM MRALHNFLTA GVPAEG Catalog Number: 5591 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGLSM MRALHNFLTA GVPAEG; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Leu - Ser - Met - Met - Arg - Ala - Leu - His -... |
$280.00 ... more info |
Catalog Number: 6206 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGGHH HHHH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - His - His - His - His - His - His -COOH ... |
$380.00 ... more info |
RQIKIWFQNRRMKWKKGGLHGRWFAGKMITAAYVPLHHHHHH Catalog Number: 6209 Category: Peptide Sequence: RQIKIWFQNR RMKWKKGGLH GRWFAGKMIT AAYVPLHHHH HH; NH2- Arg - Gln - Ile - Lys - Ile - Trp - Phe - Gln - Asn - Arg - Arg - Met - Lys - Trp - Lys - Lys - Gly - Gly - Leu - His - Gly - Arg - Trp - Phe... |
$280.00 ... more info |
Catalog Number: 6284 Category: Peptide Sequence: RQPKIWFPNRRKPWKKRPRPDDLEI Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
RQPKIWFPNRRKPWKKTKKSTKTINPSKYQTIRK Catalog Number: 6285 Category: Peptide Sequence: RQPKIWFPNRRKPWKKTKKSTKTINPSKYQTIRK Modifications: Quantity: 4mg Purity: >95% Notes: |
$190.08 ... more info |
Product NameRR-SRCProduct Quantity5mgCatalog Number LT2171Molecular Weight1519.7FormulaC64H106N22O21SequenceArg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Al a-Ala-Arg-Gly |
$389.00 ... more info |
Product NameRRBP1 Rabbit pAb Catalog NumberLTA22752 Quantity100ul Price $ 389 In stock DescriptionRRBP1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of... |
$280.00 ... more info |
Catalog Number: 5856 Category: Peptide Sequence: RRCS{pS}YLLSEDML Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$550.00 ... more info |
Catalog Number: 6001 Category: Peptide Sequence: RRFYGPV Modifications: Quantity: 50mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameRRM1 Rabbit pAb Catalog NumberLTA23749 Quantity100ul Price $ 389 In stock DescriptionRRM1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 543-792 of... |
Displaying 6601 to 6610 (of 7701 Products)
