My Account Information
Displaying 5021 to 5030 (of 7701 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
Catalog Number: 5583 Category: Peptide Sequence: LTDTGLSL Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
LTGLGGIGRKFAPLYVRDRKFDLLQFVNLTRSKKQ Catalog Number: 5392 Category: Peptide Sequence: LTGLGGIGRKFAPLYVRDRKFDLLQFVNLTRSKKQ Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5501 Category: Peptide Sequence: LTSELPQWLS ANRAVKPTGS Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$280.00 ... more info |
Product Name VEGF-IQ: Ac-LTYQDLLQLQY-{D-Arg}-NH2, Related products Ac-KLTWQELYQLKYKGI-NH2; Ac-KQLLWIRSGDRPWYTS-NH2 Product Quantity 4mg Catalog Number LT8211 Molecular Weight 1594.81 Sequence Ac- LTYQDLLQLQY-{D-Arg}-NH2 Product... |
$389.00 ... more info |
Product NameLUC7L2 Rabbit pAb Catalog NumberLTA23526 Quantity100ul Price $ 389 In stock DescriptionLUC7L2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 313-392... |
$501.00 ... more info |
Product NameLumican (LUM) Rabbit mAb Catalog NumberLTA22181 Quantity100ul Price $ 501 In stock DescriptionLumican (LUM) Rabbit mAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino... |
$207.36 ... more info |
Luteinizing Hormone Releasing Hormone LH-RH Product NameLuteinizing Hormone Releasing Hormone LH-RHProduct Quantity5mg Product Description This decapeptide is a hypothalamic hormone that controls the release of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) in the pituitary... |
$207.36 ... more info |
Luteinizing Hormone-Releasing Hormone, free acid, human; LH-RH, Product NameLuteinizing Hormone-Releasing Hormone, free acid, human; LH-RH, free acid, humanProduct Quantity5mgCatalog Number LT1767Molecular Weight1304.45FormulaC58H81N17O16SSequenceGlp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-Cys |
$389.00 ... more info |
Product NameLY6E Rabbit pAb Catalog NumberLTA21202 Quantity100ul Price $ 389 In stock DescriptionLY6E Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of... |
$389.00 ... more info |
Product NameLY75 Rabbit pAb Catalog NumberLTA21040 Quantity100ul Price $ 389 In stock DescriptionLY75 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 440-680 of... |
Displaying 5021 to 5030 (of 7701 Products)
