My Account Information
Displaying 481 to 490 (of 7704 Products)
| Price | Product Name |
|---|---|
$250.00 ... more info |
[Val671]-Amyloid b/A4 Protein Precursor770 (667-676) Product Name[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)Product Quantity5mgCatalog Number LT0786Molecular Weight1179.31FormulaC51H82N14O18SequenceSer-Glu-Val-Lys-Val-Asp-Ala-Glu-Phe-Arg, SEVKVDAEFR |
$450.00 ... more info |
{Acetylation}{d-Beta-D}{dS}{dY}GEVGVRQAPF{dP}{dS}K{dA}{dS}{dC}-N Catalog Number: 5925 Category: Peptide Sequence: {Acetylation}{d-Beta-D}{dS}{dY}GEVGVRQAPF{dP}{dS}K{dA}{dS}{dC}-NH2 Modifications: Quantity: 4mg Purity: >95% Notes: |
$480.00 ... more info |
Catalog Number: 5989 Category: Peptide Sequence: {Cy5}-Cys-HHHHHHHHHLPETGG Modifications: Quantity: 1mg Purity: >95% Notes: Other related LPETG products: Cat. No Product Name Applications Price Order 5467... |
$280.00 ... more info |
Catalog Number: 5946 Category: Peptide Sequence: {Cys}-{Ahx}-GANASDGPVPSPRAVD Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
{D-Ser}-LNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6110 Category: Peptide Sequence: {D-Ser}-LNPEWNETKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: 5720 Category: Peptide Sequence: {D-Ser}LGAEQ Modifications: Quantity: 100mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6271 Category: Peptide Sequence: {FITC}-{Ahx}-LPETGS Modifications: FITC Quantity: 4mg Purity: >95% Formula: C52H64N8O17S1 Molecular Weight: 1105.1 Notes: Other related LPETG products: Cat. No Product Name ... |
$280.00 ... more info |
Catalog Number: 5804 Category: Peptide Sequence: {FITC}-TENLYFQSGTK Modifications: Quantity: 4mg Purity: >95% Notes: TEV Protease and Its Unique Sequence Specificity : Tobacco Etch Virus (TEV) protease is a highly sequence-specific... |
$580.00 ... more info |
{For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF Catalog Number: 5890 Category: Peptide Sequence: {For}-MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF Modifications: Quantity: 4mg Purity: >95% Notes: |
$380.00 ... more info |
Catalog Number: 5929 Category: Peptide Sequence: {KLH}-{Cys*}-SLIPVGPIQW* Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 481 to 490 (of 7704 Products)
