My Account Information
Displaying 4821 to 4830 (of 7701 Products)
| Price | Product Name |
|---|---|
$180.00 ... more info |
Product Name GMC oxidoreductase [Streptomyces exfoliatus] Ac-KTYLAQAAATG-NH2 Product Quantity 4mg Purity >95% Catalog Number LT8223 Molecular Weight1135.29FormulaC50H82N14O16Sequence Ac-KTYLAQAAATG-NH2; Ac- Lys - Thr - Tyr - Leu - Ala - Gln -... |
$501.00 ... more info |
Product NameKu70 Rabbit mAb Catalog NumberLTA21947 Quantity100ul Price $ 501 In stock DescriptionKu70 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 500-609 of human Ku70... |
$389.00 ... more info |
Product NameKu70 Rabbit pAb Catalog NumberLTA20880 Quantity100ul Price $ 389 In stock DescriptionKu70 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Ku70... |
$501.00 ... more info |
Product NameKu80 Rabbit mAb Catalog NumberLTA22830 Quantity100ul Price $ 501 In stock DescriptionKu80 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 633-732 of human Ku80... |
$280.00 ... more info |
Catalog Number: 5960 Category: Peptide Sequence: KVAKFK Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5546 Category: Peptide Sequence: KVKSGWLDK Modifications: Quantity: 4mg Purity: >95% Notes: |
$330.00 ... more info |
Catalog Number: 5545 Category: Peptide Sequence: KVKSGWLGK Modifications: Quantity: 4mg Purity: >95% Notes: |
$183.60 ... more info |
Product NameKyotorphinProduct Quantity10mg Product Description Kyotorphin is an endogenous neuropeptide with a role in pain regulation in the brain. Catalog Number LT1725Molecular Weight337.4FormulaC15H23N5O4SequenceTyr-Arg |
$389.00 ... more info |
Product NameL3MBTL2 Rabbit pAb Catalog NumberLTA21318 Quantity100ul Price $ 389 In stock DescriptionL3MBTL2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$280.00 ... more info |
LAGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5756 Category: Peptide Sequence: LAGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4821 to 4830 (of 7701 Products)
