My Account Information
Displaying 4801 to 4810 (of 7701 Products)
| Price | Product Name |
|---|---|
$350.00 ... more info |
Catalog Number: LT5968 Category: A-beta T cell epitope Sequence: KLVFFAEDVGSNKGA Formula: C72H112N18O22 Quantity: 4mg Purity: >95% MW: 1581.79 Description: Our KLVFFAEDVGSNKGA Peptide is a state-of-the-art research tool... |
$389.00 ... more info |
Product NameKMT2A Rabbit pAb Catalog NumberLTA22842 Quantity100ul Price $ 389 In stock DescriptionKMT2A Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 2829-2883... |
$250.00 ... more info |
Catalog Number: 5253 Category: Peptide Sequence: KNGSFIIDGKSRKEC Modifications: Quantity: 4 mg Purity: >95% Formula: C71H120N22O23S Molecular Weight: 1681.93 For research purposes only! Not for human or animal therapeutic or... |
$389.00 ... more info |
Product NameKNTC1 Rabbit pAb Catalog NumberLTA23497 Quantity100ul Price $ 389 In stock DescriptionKNTC1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 2084-2209... |
$280.00 ... more info |
KNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDV-K(Biotin) Catalog Number: 5551 Category: Peptide Sequence: KNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDV-K(Biotin) Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameKPNA1 Rabbit pAb Catalog NumberLTA23981 Quantity100ul Price $ 389 In stock DescriptionKPNA1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of... |
$501.00 ... more info |
Product NameKPNB1 Rabbit mAb Catalog NumberLTA20145 Quantity100ul Price $ 501 In stock DescriptionKPNB1 Rabbit mAb is produced by immunizing Rabbit with Recombinant protein of human KPNB1. AliasKPNB1; IMB1; IPO1; IPOB; Impnb; NTF97;... |
$280.00 ... more info |
Catalog Number: 6294 Category: Peptide Sequence: KQIEIKKFK Quantity: 4mg Purity: >95% Description: GAP19 Peptide (KQIEIKKFK) – Highly Specific Connexin43 Hemichannel Inhibitory Peptide GAP19 (sequence KQIEIKKFK) is a selectively... |
$280.00 ... more info |
Product Name VEGF-HPLW: Ac-KQLLWIRSGDRPWYTS-NH2; Related products KLTWQELYQLKYKGI; Ac-LTYQDLLQLQY-{D-Arg}-NH2 Product Quantity 4mg Catalog Number LT8210 Molecular Weight 2047.32 Sequence Ac-KQLLWIRSGDRPWYTS-NH2 Product... |
$389.00 ... more info |
Product NameKRAS Rabbit pAb Catalog NumberLTA22465 Quantity100ul Price $ 389 In stock DescriptionKRAS Rabbit pAb is produced by immunizing Rabbit with A synthetic phosphorylated peptide around S89 of human KRAS (NP_001356715.1). ... |
Displaying 4801 to 4810 (of 7701 Products)
