Scientific Background | KNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDV-K(Biotin) is a 49-residue synthetic peptide with the sequence Lys-Asn-Trp-Arg-Leu-Lys-Asn-Ile-Asn-Ser-Ile-Asn-Phe-Asp-Asn-Pro-Val-Tyr-Gln-Lys-Thr-Thr-Glu-Asp-Glu-Val-His-Ile-Cys-His-Asn-Gln-Asp-Gly-Tyr-Ser-Tyr-Pro-Ser-Arg-Gln-Met-Val-Ser-Leu-Glu-Asp-Asp-Val. Biotin provides an affinity handle for streptavidin-based capture or detection. The sequence contains 1 cysteine residue, allowing thiol/disulfide chemistry when available; contains 3 Lys and 2 Arg residues, contributing cationic character; contains 5 aromatic residues. These sequence-derived properties describe the reagent chemically; no specific biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties support reagent selection and experimental planning but do not establish biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended conditions. |
