My Account Information
Displaying 4761 to 4770 (of 7701 Products)
| Price | Product Name |
|---|---|
$389.00 ... more info |
Product NameKininogen 1 (KNG1) Rabbit pAb Catalog NumberLTA24225 Quantity100ul Price $ 389 In stock DescriptionKininogen 1 (KNG1) Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence... |
$389.00 ... more info |
Product NameKIR2DL4 Rabbit pAb Catalog NumberLTA23298 Quantity100ul Price $ 389 In stock DescriptionKIR2DL4 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$389.00 ... more info |
Product NameKIR3DL3 Rabbit pAb Catalog NumberLTA21039 Quantity100ul Price $ 389 In stock DescriptionKIR3DL3 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$389.00 ... more info |
Product NameKIRREL Rabbit pAb Catalog NumberLTA24495 Quantity100ul Price $ 389 In stock DescriptionKIRREL Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 17-200... |
$194.40 ... more info |
Product NameKisspeptin-13 (4-13) (human)Product Quantity5mgCatalog Number LT1719Molecular Weight1302.47FormulaC63H83N17O14SequenceTyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 |
$252.72 ... more info |
Product NameKisspeptin-13 (human)Product Quantity5mgCatalog Number LT1720Molecular Weight1626.85FormulaC78H107N21O18SequenceLeu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 |
$518.40 ... more info |
Product NameKisspeptin-54 (27-54) (human)Product Quantity5mgCatalog Number LT1721Molecular Weight3229.72FormulaC149H226N42O39SequenceIle-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 |
$280.00 ... more info |
KISTVKVQGNDISHKLQISKVRKKDEGLYEC Catalog Number: 6143 Category: Peptide Sequence: KISTVKVQGNDISHKLQISKVRKKDEGLYEC Modifications: Quantity: 4mg Purity: >95% Notes: |
$285.12 ... more info |
Product NameKK4AProduct Quantity5mgCatalog Number LT1722Molecular Weight1640.06FormulaC74H138N22O19SequenceLys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Val-Leu-Ser-Gly-Lys |
$290.00 ... more info |
KKDAGLYFFRLERGKTKYNYMWDKMTLVVT Catalog Number: 5802 Category: Peptide Sequence: KKDAGLYFFRLERGKTKYNYMWDKMTLVVT Modifications: Quantity: 4mg Purity: >95% Notes: |
Displaying 4761 to 4770 (of 7701 Products)
