My Account Information
Displaying 331 to 340 (of 7696 Products)
| Price | Product Name |
|---|---|
$1,367.28 ... more info |
Aldosterone Secretion Inhibiting Factor (1-35) (bovine) Product NameAldosterone Secretion Inhibiting Factor (1-35) (bovine)Product Quantity5mgCatalog Number LT0926Molecular... |
$280.00 ... more info |
Catalog Number: 6173 Category: Peptide Sequence: ALEHLFTLYEKALKALEDLLKKLL Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$450.00 ... more info |
Catalog Number: LT8243 Category: Alexa 647-C-LPETG Sequence: Alexa 647-Cys-LPETG; Alexa 647 conjugation on Cysteine Quantity: 1mg Purity: >95% Description: LPETG Motif Peptide (Fluorescent Dye-Labeled LPETGG) Discover our advanced LPETG... |
$450.00 ... more info |
Catalog Number: LT8253 Category: Alexa546- GGLPETGGHH Sequence: Alexa546- GGLPETGGHH, Alexa546 NHS conjugation at the N-terminal amine Quantity: 1mg Purity: >95% Description: LPETG Motif Peptide (Fluorescent Dye-Labeled LPETGG) Discover... |
$350.00 ... more info |
Catalog Number: LT8236 Category: ALFA-Tag Peptide Sequence: Cys-PSRLEEELRRRLTEP-Amide Quantity: 4mg Purity: >95% Description: The ALFA-tag peptide, with the sequence Cys-PSRLEEELRRRLTEP-Amide , is a meticulously engineered 15-amino-acid... |
$280.00 ... more info |
ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Catalog Number: 5755 Category: Peptide Sequence: ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5428 Category: Peptide Sequence: ALHPELR Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5948 Category: Peptide Sequence: ALHRLSPGPRAY-Ahx-Cys Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameALK Rabbit pAb Catalog NumberLTA20807 Quantity100ul Price $ 389 In stock DescriptionALK Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 1550-1620 of human ALK... |
$336.00 ... more info |
Alkali-tolerant Recombinant Protein A Agarose Catalog Number: LT12014 Packing Details: 1 mL resin, crosslinked 6% beaded agarose supplied as 50% slurry (e.g., 1mL of settled resin is equivalent to 2mL of 50% slurry) in 0.02% sodium azide Binding Capacity: 10~20 mg/ml rabbit IgG or 15~25... |
Displaying 331 to 340 (of 7696 Products)
