My Account Information
Displaying 3271 to 3280 (of 7701 Products)
| Price | Product Name |
|---|---|
$389.00 ... more info |
Product NameFUCA2 Rabbit pAb Catalog NumberLTA22789 Quantity100ul Price $ 389 In stock DescriptionFUCA2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 118-467... |
$501.00 ... more info |
Product NameFukutin Rabbit mAb Catalog NumberLTA24171 Quantity100ul Price $ 501 In stock DescriptionFukutin Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 362-461 of human... |
$389.00 ... more info |
Product NameFurin Rabbit pAb Catalog NumberLTA20048 Quantity100ul Price $ 389 In stock DescriptionFurin Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human... |
$389.00 ... more info |
Product NameFurin Rabbit pAb Catalog NumberLTA23737 Quantity100ul Price $ 389 In stock DescriptionFurin Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 700 to the... |
$389.00 ... more info |
Product NameFUT8 Rabbit pAb Catalog NumberLTA23377 Quantity100ul Price $ 389 In stock DescriptionFUT8 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 376-575 of... |
$280.00 ... more info |
Catalog Number: 5874 Category: Peptide Sequence: FVSVTETTDKVIHNSMSIAE-Ahx-Cys Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 6220 Category: Peptide Sequence: FVWSSLDTPSQR-GS-Lys(Biotin) Modifications: Quantity: 1-2mg Purity: >95% Notes: |
$280.00 ... more info |
Catalog Number: 5679 Category: Peptide Sequence: FWF Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
FWVSLNPEWNETKKGFYKKKQCRPSKGRKRGFCW Catalog Number: 5477 Category: Peptide Sequence: FWVSLNPEWNETKKGFYKKKQCRPSKGRKRGFCW Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameFXN / Frataxin Rabbit pAb Catalog NumberLTA22352 Quantity100ul Price $ 389 In stock DescriptionFXN / Frataxin Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to... |
Displaying 3271 to 3280 (of 7701 Products)
