Scientific Background | FWVSLNPEWNETKKGFYKKKQCRPSKGRKRGFCW is a 34-residue synthetic peptide with the sequence Phe-Trp-Val-Ser-Leu-Asn-Pro-Glu-Trp-Asn-Glu-Thr-Lys-Lys-Gly-Phe-Tyr-Lys-Lys-Lys-Gln-Cys-Arg-Pro-Ser-Lys-Gly-Arg-Lys-Arg-Gly-Phe-Cys-Trp. The sequence contains 2 cysteine residues, which can support thiol-selective conjugation or disulfide chemistry when the thiol is available; is enriched in basic residues (7 Lys and 3 Arg), contributing cationic character under many aqueous conditions; contains 7 aromatic residues (Phe/Trp/Tyr), which can contribute to hydrophobic or aromatic interactions. No specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties are provided to support reagent selection and experimental planning. They do not establish a biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions. |