My Account Information
Displaying 3191 to 3200 (of 7701 Products)
| Price | Product Name |
|---|---|
$250.00 ... more info |
Catalog Number: 5345 Category: Peptide Sequence: FITC-NTGSPYEGGGS Modifications: Quantity: 1 mg Purity: >95% Formula: C68H82N14O25S Molecular Weight: 1527.54 For research purposes only! Not for human or animal therapeutic or... |
$250.00 ... more info |
Catalog Number: 5346 Category: Peptide Sequence: FITC-RRRRRRRGGGS Modifications: Quantity: 1 mg Purity: >95% Formula: C78H122N34O19S Molecular Weight: 1872.11 For research purposes only! Not for human or animal therapeutic or... |
$280.00 ... more info |
FITC-SGTTATPLIIALLLSEIKKAGKITLELALQNADRKEVAAE Catalog Number: 5416 Category: Peptide Sequence: FITC-SGTTATPLIIALLLSEIKKAGKITLELALQNADRKEVAAE Modifications: Quantity: 1-4mg Purity: >95% Notes: |
$300.00 $150.00Save: 50% off ... more info |
Product Name FITC-Stearyl-R8 Product Quantity 1mg Purity 95.89% Catalog Number LT12013 Molecular Weight 2107.64 Formula C95H159N37O16S Sequence CH3(CH2)16-CONH-RRRRRRRRGK(FITC)-NH2 Description Polyarginine peptides, which are very... |
$250.00 ... more info |
Catalog Number: 5239 Category: Peptide Sequence: FITC-TDD{pY}AEIIDEE Modifications: FITC, Amidation, {pY} Quantity: 1 mg Purity: >95% Formula: C82H105N14O34PS Molecular Weight: 1893.84 For research purposes only! Not for human or... |
$350.00 ... more info |
FITC-TKQGVAEAAGKTKEGVLYVG-Amide Catalog Number: 6017 Category: Peptide Sequence: FITC-TKQGVAEAAGKTKEGVLYVG-Amide Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
FITC-VAAAEKTKQGVAEAAGKTKEGVLYVGSKTK-Amide Catalog Number: 6013 Category: Peptide Sequence: FITC-VAAAEKTKQGVAEAAGKTKEGVLYVGSKTK-Amide Modifications: Quantity: 4mg Purity: >95% Notes: |
$350.00 ... more info |
FITC-VAEAAGKTKEGVLYVGSKTK-Amide Catalog Number: 6015 Category: Peptide Sequence: FITC-VAEAAGKTKEGVLYVGSKTK-Amide Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameFKBP11 Rabbit pAb Catalog NumberLTA20060 Quantity100ul Price $ 389 In stock DescriptionFKBP11 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 28-150... |
$501.00 ... more info |
Product NameFKBP12 Rabbit mAb Catalog NumberLTA22228 Quantity100ul Price $ 501 In stock DescriptionFKBP12 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 29-108 of human... |
Displaying 3191 to 3200 (of 7701 Products)
