Scientific Background | FITC-SGTTATPLIIALLLSEIKKAGKITLELALQNADRKEVAAE is a 40-residue synthetic peptide with the sequence Ser-Gly-Thr-Thr-Ala-Thr-Pro-Leu-Ile-Ile-Ala-Leu-Leu-Leu-Ser-Glu-Ile-Lys-Lys-Ala-Gly-Lys-Ile-Thr-Leu-Glu-Leu-Ala-Leu-Gln-Asn-Ala-Asp-Arg-Lys-Glu-Val-Ala-Ala-Glu. FITC provides a fluorescent label for optical detection. The sequence is enriched in basic residues (4 Lys and 1 Arg), contributing cationic character under many aqueous conditions; contains a relatively high fraction of hydrophobic residues, which can influence solubility and nonspecific adsorption. No specific receptor, enzyme, pathway, disease association, or biological activity is assigned without product-specific experimental evidence. |
Experimental Notes | Sequence-derived chemical properties are provided to support reagent selection and experimental planning. They do not establish a biological function. Solubility, aggregation, adsorption, conjugation efficiency, and assay performance should be validated under the intended experimental conditions. |
