My Account Information
Displaying 3031 to 3040 (of 7701 Products)
| Price | Product Name |
|---|---|
$389.00 ... more info |
Product NameEWSR1 Rabbit pAb Catalog NumberLTA24270 Quantity100ul Price $ 389 In stock DescriptionEWSR1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of... |
$350.00 $99.00Save: 72% off ... more info |
Catalog Number: LT8172 Category: Peptide Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, amidation Chemistry : Sequence: NH2- His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala -... |
$576.72 ... more info |
Product NameExendin (9-39)Product Quantity5mg Product Description Exendin (9-39) corresponds to the C-terminal part of the bioactive peptides exendin-3 and -4 isolated from the venom of Heloderma suspectum. Exendin is a potent Glucagon-Like... |
$959.04 ... more info |
Product NameExendin 3Product Quantity5mgCatalog Number LT1409Molecular... |
$959.04 ... more info |
Product NameExendin 4Product DescriptionExendin-4, originally isolated from Heloderma suspectum venom, is a 39 amino acid peptide, activates GLP-1 (glucagon-like peptide-1) receptors to increase intracellular cAMP in pancreatic acinar cells and has... |
$270.00 ... more info |
Product NameExendin 4 (1-8)Product Quantity10mgCatalog Number LT1411Molecular Weight833.86FormulaC35H51N11O13SequenceHis-Gly-Glu-Gly-Thr-Phe-Thr-Ser-NH2 |
$648.00 ... more info |
Product NameExendin 4 (3-39)Product Quantity5mgCatalog Number LT1412Molecular... |
$680.40 ... more info |
Product NameExendin 4 (3-39)Product Quantity5mgCatalog Number LT1413Molecular... |
$389.00 ... more info |
Product NameEXOC4 Rabbit pAb Catalog NumberLTA22865 Quantity100ul Price $ 389 In stock DescriptionEXOC4 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of... |
$389.00 ... more info |
Product NameEXOSC1 Rabbit pAb Catalog NumberLTA21286 Quantity100ul Price $ 389 In stock DescriptionEXOSC1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-195... |
Displaying 3031 to 3040 (of 7701 Products)
