My Account Information
Displaying 261 to 270 (of 7696 Products)
| Price | Product Name |
|---|---|
$237.60 ... more info |
Product NameAF-2, nematodeProduct Quantity10mgCatalog Number LT0914Molecular Weight991.17FormulaC47H70N14O10SequenceLys-His-Glu-Tyr-Leu-Arg-Phe-NH2 |
$250.00 ... more info |
Catalog Number: 5219 Category: Peptide Sequence: AFLTVKKQM Modifications: Quantity: 2 mg Purity: >95% Formula: C49H84N12O12S Molecular Weight: 1065.34 For research purposes only! Not for human or animal therapeutic or diagnostic... |
$280.00 ... more info |
AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Catalog Number: 6112 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCW Modifications: Quantity: 4mg Purity: >95% Notes: |
$280.00 ... more info |
AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Catalog Number: 6113 Category: Peptide Sequence: AFNSYELGSKGFYKKKQCRPSKGRKRGFCWAVDKY Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameAGA Rabbit pAb Catalog NumberLTA24240 Quantity100ul Price $ 389 In stock DescriptionAGA Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 24-346 of... |
$389.00 ... more info |
Product NameAGER Rabbit pAb Catalog NumberLTA24248 Quantity100ul Price $ 389 In stock DescriptionAGER Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of... |
$389.00 ... more info |
Product NameAGER Rabbit pAb Catalog NumberLTA23678 Quantity100ul Price $ 389 In stock DescriptionAGER Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 40-210 of... |
$389.00 ... more info |
Product NameAGFG1 Rabbit pAb Catalog NumberLTA23880 Quantity100ul Price $ 389 In stock DescriptionAGFG1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of... |
$501.00 ... more info |
Product NameAggrecan Rabbit mAb Catalog NumberLTA22277 Quantity100ul Price $ 501 In stock DescriptionAggrecan Rabbit mAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$389.00 ... more info |
Product NameAggrecan Rabbit pAb Catalog NumberLTA22591 Quantity100ul Price $ 389 In stock DescriptionAggrecan Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
Displaying 261 to 270 (of 7696 Products)
