My Account Information
Displaying 2441 to 2450 (of 7701 Products)
| Price | Product Name |
|---|---|
$226.80 ... more info |
Product NameCTX IV (6-12)Product Quantity5mgCatalog Number LT1300Molecular Weight899.14FormulaC48H70N10O7SequenceLeu-Ile-Pro-Pro-Phe-Trp-Lys-NH2 |
$389.00 ... more info |
Product NameCUL4B Rabbit pAb Catalog NumberLTA23169 Quantity100ul Price $ 389 In stock DescriptionCUL4B Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of... |
$389.00 ... more info |
Product NameCullin 3 Rabbit pAb Catalog NumberLTA21673 Quantity100ul Price $ 389 In stock DescriptionCullin 3 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids... |
$800.00 ... more info |
Curli production assembly transport protein CsgF Product Name Curli production assembly/transport protein CsgF [Escherichia coli] TFQFRNPNFGGNPSNGAFLLNSAQAQNSYKDP- Cys (DBCO) Product Quantity 4mg Catalog Number LT8216 Sequence Curli production assembly/transport protein CsgF... |
$389.00 ... more info |
Product NameCWC22 Rabbit pAb Catalog NumberLTA23545 Quantity100ul Price $ 389 In stock DescriptionCWC22 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 639-908... |
$389.00 ... more info |
Product NameCX3CL1 Rabbit pAb Catalog NumberLTA24422 Quantity100ul Price $ 389 In stock DescriptionCX3CL1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence within amino acids 318-397 of human... |
$389.00 ... more info |
Product NameCXCL12 Rabbit pAb Catalog NumberLTA23669 Quantity100ul Price $ 389 In stock DescriptionCXCL12 Rabbit pAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 40 to the... |
$389.00 ... more info |
Product NameCXCL2 Rabbit pAb Catalog NumberLTA23115 Quantity100ul Price $ 389 In stock DescriptionCXCL2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of... |
$501.00 ... more info |
Product NameCXCR3 Rabbit mAb Catalog NumberLTA21995 Quantity100ul Price $ 501 In stock DescriptionCXCR3 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human... |
$389.00 ... more info |
Product NameCXCR3 Rabbit pAb Catalog NumberLTA22189 Quantity100ul Price $ 389 In stock DescriptionCXCR3 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of... |
Displaying 2441 to 2450 (of 7701 Products)