My Account Information
Displaying 1851 to 1860 (of 7696 Products)
| Price | Product Name |
|---|---|
$280.00 ... more info |
CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Catalog Number: 5724 Category: Peptide Sequence: CPQGRMRIATEVLKSKPNSSHWHTGIRQKAGS Modifications: Quantity: 4mg Purity: >95% Notes: |
$389.00 ... more info |
Product NameCPT1C Rabbit pAb Catalog NumberLTA24170 Quantity100ul Price $ 389 In stock DescriptionCPT1C Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 270-400... |
$501.00 ... more info |
Product NameCPT2 Rabbit mAb Catalog NumberLTA20723 Quantity100ul Price $ 501 In stock DescriptionCPT2 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 559-658 of human CPT2... |
$389.00 ... more info |
Product NameCPT2 Rabbit pAb Catalog NumberLTA22915 Quantity100ul Price $ 389 In stock DescriptionCPT2 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 404-658 of... |
$389.00 ... more info |
Product NameCPVL Rabbit pAb Catalog NumberLTA22859 Quantity100ul Price $ 389 In stock DescriptionCPVL Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 127-476 of... |
$501.00 ... more info |
Product NameCR2/CD21 Rabbit mAb Catalog NumberLTA23143 Quantity100ul Price $ 501 In stock DescriptionCR2/CD21 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 934-1033 of... |
$389.00 ... more info |
Product NameCRB1 Rabbit pAb Catalog NumberLTA21626 Quantity100ul Price $ 389 In stock DescriptionCRB1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of... |
$389.00 ... more info |
Creatine kinase B type (CKB) Rabbit pAb Product NameCreatine kinase B type (CKB) Rabbit pAb Catalog NumberLTA23109 Quantity100ul Price $ 389 In stock DescriptionCreatine kinase B type (CKB) Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a... |
$501.00 ... more info |
Product NameCREB1 Rabbit mAb Catalog NumberLTA21707 Quantity100ul Price $ 501 In stock DescriptionCREB1 Rabbit mAb is produced by immunizing Rabbit with A synthetic peptide corresponding to a sequence within amino acids 200-300 of human... |
$389.00 ... more info |
Product NameCREB1 Rabbit pAb Catalog NumberLTA21844 Quantity100ul Price $ 389 In stock DescriptionCREB1 Rabbit pAb is produced by immunizing Rabbit with Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of... |
Displaying 1851 to 1860 (of 7696 Products)
